PTD-DBM | 5mg
PTD-DBM | 5mg $82.15
Back to products
“2X” Tesamorelin | Ipamorelin | 10/2mg
“2X” Tesamorelin | Ipamorelin | 10/2mg $78.00
Teriparatide | 10mg - Image 1

    Teriparatide | 10mg

    $82.10

    Description

    Teriparatide 10mg peptide is a synthetic form of the biologically active N-terminal fragment of human parathyroid hormone, consisting of the first 34 amino acids of human PTH (1–34). It is commonly studied in laboratory environments for its interaction with parathyroid hormone receptors and its role in bone metabolism, cellular signaling, and osteoblast-related research pathways.

    Specifications

    CAS: 52232-67-4
    Molecular Formula: C181H291N55O51S2
    Molecular Weight: 4118 g/mol
    Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
    Type: Human parathyroid hormone analog / PTH (1–34)
    Length: 34 amino acids
    Form: Lyophilized peptide powder
    Purity: ≥99%
    Storage: 2–8°C

    The CAS number, molecular formula, molecular weight, and 34-amino-acid sequence are reported by PubChem.

    Research Applications

    • Commonly studied in parathyroid hormone receptor signaling research
    • Investigated in laboratory models involving bone metabolism and remodeling
    • Studied in research involving osteoblast differentiation and cellular signaling
    • Utilized in experimental models examining PTH-mediated calcium and phosphate regulatory pathways
    • Investigated in bone formation and skeletal tissue research
    Add to wishlist

    Reviews

    There are no reviews yet.

    Be the first to review “Teriparatide | 10mg”

    Your email address will not be published. Required fields are marked *

    Related Products

    Add to wishlist

    “2X” Tesamorelin | Ipamorelin | 10/2mg

    ,
    $78.00

    “2X” Tesamorelin + Ipamorelin peptide blend (10/2mg) is a dual-peptide blend commonly studied in laboratory environments for its role in growth hormone-releasing hormone (GHRH) and ghrelin receptor signaling pathways.

    Specifications

    Composition: Tesamorelin | Ipamorelin
    Ratio: 10mg / 2mg
    Form: White lyophilized powder
    Purity: ≥99%
    Storage: 2–8°C

    Research Applications

    • Commonly studied in GHRH and ghrelin receptor signaling research
    • Investigated for roles in peptide-based regulatory pathways
    • Utilized in laboratory studies involving endocrine-related mechanisms
    Add to wishlist

    “3X” Tesamorelin | MGF | Ipamorelin 5.0/1.5/2.5 mg

    , ,
    $62.00

    “3X” Tesamorelin + MGF + Ipamorelin (5/1.5/2.5mg)

    A multi-peptide blend for GHRH, MGF and ghrelin receptor research.

    • Form: Lyophilized powder
    • Purity: ≥99%
    • Storage: 2–8°C
    Add to wishlist

    4X – Tesamorelin | Ipamorelin | MGF | GHRP-2

    , ,
    $72.00

    4X Peptide Blend (Tesamorelin | Ipamorelin | MGF | GHRP-2)

    A four-peptide blend for GHRH, ghrelin receptor and MGF signaling research.

    • Form: Lyophilized powder
    • Purity: ≥99%
    • Storage: 2–8°C
    Add to wishlist

    Adamax | 10mg

    , ,
    $73.60

    Adamax | 10mg

    A modified N-acetyl Semax analog for neuropeptide signaling research.

    • Sequence: Ac-MEHFPGP-AG-NH2
    • Molecular Weight: 1032.24 g/mol
    • Form: Lyophilized powder
    • Purity: ≥99%
    • Storage: 2–8°C
    Add to wishlist

    AHK-Cu | 100mg

    ,
    $80.12

    AHK-Cu (Copper Tripeptide-3) | 100mg

    A copper-binding tripeptide (Ala-His-Lys) for hair follicle and dermal signaling research.

    • CAS: 767286-83-9
    • Molecular Weight: 415.93 g/mol
    • Form: Blue lyophilized powder
    • Purity: ≥99%
    • Storage: -20°C, protected from light
    Add to wishlist

    AOD-9604 | 5 mg

    ,
    $73.60

    AOD-9604 | 5mg

    A synthetic hGH fragment (177-191) for metabolic signaling research.

    • CAS: 221231-10-3
    • Molecular Weight: 1815.1 g/mol
    • Form: Lyophilized powder
    • Purity: ≥99%
    • Storage: 2–8°C
    Add to wishlist

    ARA 290 (Cibinetide)

    , ,
    $87.40

    ARA 290 (Cibinetide) | 16mg

    A synthetic 11-amino-acid peptide for cellular and receptor signaling research.

    • CAS: 1208243-50-8
    • Molecular Weight: 1257.3 g/mol
    • Form: Lyophilized powder
    Add to wishlist

    BPC-157 | 10mg | 25mg

    ,
    Price range: $48.00 through $86.00
    This product has multiple variants. The options may be chosen on the product page

    A synthetic peptide derived from a gastric protein, studied in cellular signaling research.

    • CAS: 137525-51-0
    • Molecular Weight: 1419.54 g/mol
    • Form: Lyophilized powder
    • Purity: ≥99%
    • Storage: 2–8°C
    Add to wishlist

    BPC-157 | TB-500 Blend

    ,
    $98.00

    BPC-157 + TB-500 Blend

    A dual-peptide blend of BPC-157 and Thymosin Beta-4 for tissue repair research.

    • Form: Lyophilized powder
    • Purity: ≥99%
    • Storage: 2–8°C
    Add to wishlist

    Cagrilintide | 10mg | 12.5mg

    ,
    Price range: $99.00 through $144.00
    This product has multiple variants. The options may be chosen on the product page

    Cagrilintide | 10mg / 12.5mg

    A synthetic long-acting amylin analog for metabolic signaling research.

    • CAS: 1415456-99-3
    • Molecular Weight: 4409 g/mol
    • Form: Lyophilized powder
    • Purity: ≥99%
    • Storage: 2–8°C

    Research use only. Not for human consumption.

    Add to wishlist

    Cardiogen | 25mg

    ,
    $62.10

    Cardiogen | 25mg

    A synthetic tetrapeptide (Ala-Glu-Asp-Arg) for cellular signaling research.

    • CAS: 132486-03-4
    • Form: Lyophilized powder
    • Purity: ≥99%
    • Storage: 2–8°C
    Add to wishlist

    CJC-1295 (no DAC) | 10mg

    ,
    $67.00

    CJC-1295 (no DAC) | 10mg

    A synthetic GHRH analog for growth hormone receptor signaling research.

    • CAS: 863288-34-0
    • Molecular Weight: 3367.9 g/mol
    • Form: Lyophilized powder
    • Purity: ≥99%
    • Storage: 2–8°C

    Recently Viewed

    “2X” Tesamorelin | Ipamorelin | 10/2mg

    $78.00

    “3X” Tesamorelin | MGF | Ipamorelin 5.0/1.5/2.5 mg

    $62.00

    4X – Tesamorelin | Ipamorelin | MGF | GHRP-2

    $72.00

    Adamax | 10mg

    $73.60

    AHK-Cu | 100mg

    $80.12

    AOD-9604 | 5 mg

    $73.60

    ARA 290 (Cibinetide)

    $87.40